Protein Info for Pf6N2E2_4422 in Pseudomonas fluorescens FW300-N2E2

Annotation: Frataxin homolog CyaY, facilitates iron supply for heme A synthesis or Fe-S cluster assembly

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01491: Frataxin_Cyay
  • amino acids 3 to 104 (102 residues), 101.8 bits, E=1.2e-33
• TIGR03421: iron donor protein CyaY
  • amino acids 4 to 107 (104 residues), 117 bits, E=1.7e-38

Best Hits

Swiss-Prot: 90% identical to CYAY_PSEPF: Iron-sulfur cluster assembly protein CyaY (cyaY) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K06202, CyaY protein (inferred from 100% identity to pba:PSEBR_c2g115)

MetaCyc: 46% identical to frataxin CyaY (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Frataxin homolog CyaY, facilitates iron supply for heme A synthesis or Fe-S cluster assembly" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

See A0A160A3X4 at UniProt or InterPro

Protein Sequence (110 amino acids)

>Pf6N2E2_4422 Frataxin homolog CyaY, facilitates iron supply for heme A synthesis or Fe-S cluster assembly (Pseudomonas fluorescens FW300-N2E2)
MSLTEARFHDLVDATQQTLEDVFDDSGLDIDLEVSAGVLTVKFENGSQLIFSRQEPLRQL
WLAAVSGGFHFDYDEESERWMCDKSEEQLGEMLERIVKQQAGVELDFEGL