Protein Info for Pf6N2E2_4400 in Pseudomonas fluorescens FW300-N2E2

Annotation: Multidrug and toxin extrusion (MATE) family efflux pump YdhE/NorM, homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 54 to 77 (24 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 241 to 266 (26 residues), see Phobius details amino acids 275 to 298 (24 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details amino acids 357 to 374 (18 residues), see Phobius details amino acids 395 to 414 (20 residues), see Phobius details amino acids 424 to 443 (20 residues), see Phobius details PF01554: MatE" amino acids 20 to 178 (159 residues), 82.1 bits, see alignment E=1.9e-27 amino acids 246 to 412 (167 residues), 98.9 bits, see alignment E=1.3e-32 TIGR00797: MATE efflux family protein" amino acids 20 to 425 (406 residues), 235.1 bits, see alignment E=6.4e-74

Best Hits

Swiss-Prot: 74% identical to NORM_PSESM: Probable multidrug resistance protein NorM (norM) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 98% identity to pba:PSEBR_a5499)

Predicted SEED Role

"Multidrug and toxin extrusion (MATE) family efflux pump YdhE/NorM, homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GTZ5 at UniProt or InterPro

Protein Sequence (466 amino acids)

>Pf6N2E2_4400 Multidrug and toxin extrusion (MATE) family efflux pump YdhE/NorM, homolog (Pseudomonas fluorescens FW300-N2E2)
MIMRHPVRTELWALLRLAGPLIASQLAHMLMVLTDTVMMARLSPEALAGGGLGAATYSFV
SIFCIGVIAAVGTLVAIRQGAGDVEGATRLTQAGLWLAWLMALMAGLLLWNLKPVLLMFG
QTETNVLSAGQFLLALPFALPGYLSFMALRGFTSAIGRATPVMVISLGGTVANFLLNYAL
ITGMFGLPKLGLMGIGLVTAIVANCMALALAWHIHRHPAYRAYPLLEGLSRPNRQYLKEL
WRLGLPIGGTYAVEVGLFAFAALCMGTMGSTSLAAHQIALQIVSVAFMVPAGMSYAITMR
IGQHYGAGQLLMARLAGRVGIGFGAAAMLAFAMVFWLLPHQLVGLFLDHDDPAFRDVINL
AVSLLAVAAWFELFDGTQTIAMGCIRGLKDAKTTFLVGLGCYWLIGAPAAWWMAFHLNWG
PTGVWWGLALGLACAAVSLTAAFEWKMKRMIRSEPGRQRFEAIQAK