Protein Info for Pf6N2E2_4358 in Pseudomonas fluorescens FW300-N2E2

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 36 to 58 (23 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details PF00892: EamA" amino acids 7 to 140 (134 residues), 45.5 bits, see alignment E=4.9e-16 amino acids 152 to 283 (132 residues), 55.1 bits, see alignment E=5.3e-19

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a5535)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A3M5 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Pf6N2E2_4358 Permease of the drug/metabolite transporter (DMT) superfamily (Pseudomonas fluorescens FW300-N2E2)
MQASFSKGVIFALSAAALNATIGVLSKVLMSNGFTASSVAVIKTVLGCLLLSALLLFIKR
PATTAKWTQAAICAFLGIFVLFHFETAAYRHYAAAGVVVMLMASASISSIVLGRIILKDA
ITANATVGAALAIAGIAVIFGADLRQGFTLQGVALASMAGCGYGAFSVAMKRMGVSGGLH
FTRQLLFFGSLYLLMPASADGFVIGELSPWAIAALLALAALPTILGFFCTTKAIEYLKPS
QVQALELTEPLFAALLAFVVLNEVPRESLYPGALLIIIGLCFSNELIRLGRRKPVPSRV