Protein Info for Pf6N2E2_4346 in Pseudomonas fluorescens FW300-N2E2

Annotation: ABC-type antimicrobial peptide transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 19 to 44 (26 residues), see Phobius details amino acids 269 to 294 (26 residues), see Phobius details amino acids 305 to 347 (43 residues), see Phobius details amino acids 361 to 386 (26 residues), see Phobius details

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 98% identity to pba:PSEBR_a5547)

Predicted SEED Role

"ABC-type antimicrobial peptide transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A188 at UniProt or InterPro

Protein Sequence (398 amino acids)

>Pf6N2E2_4346 ABC-type antimicrobial peptide transport system, permease component (Pseudomonas fluorescens FW300-N2E2)
MRGALVASLAWQDYRNDAWLSACSVLALVAVVAPLLVLFGLKFGLVSSLTERLQNDPATR
EIIPLGGGRFSAEFIEQLSQRGDVAFALPRTRQIAATADLSSDASVVTVEMIPTAANDPL
FEHLPVPQGLDQVVLSQTAAEKLGAKAGDWVQASFGRQVAGRSEAQRTRVQVLHVLPLEA
FARDGLFAPLALLEAAEDYRDGRAVPAFGWPGDAVSVAGQRVYPAFRLYARSLGDVEPLR
RYFAGQNLLVSTQAQTIAQVQSLSRNLSIVFWIIAGLALAGAFAAIFAGALAAVERKRRE
LSVLRLLGVSTAALLLFVVLQALYSATFAALLSAGLYGLAQSGLNYLFAQMPGEYASHLL
VRHYTLALVAVLGVSAVAAACGGWRVARIQACEGIRDV