Protein Info for Pf6N2E2_4342 in Pseudomonas fluorescens FW300-N2E2

Annotation: Protein phosphatase ImpM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF09867: TagF_N" amino acids 5 to 139 (135 residues), 160.8 bits, see alignment E=9.1e-52 TIGR03373: type VI secretion-associated protein, BMA_A0400 family" amino acids 5 to 139 (135 residues), 154.9 bits, see alignment E=6.7e-50

Best Hits

KEGG orthology group: K11890, type VI secretion system protein ImpM (inferred from 99% identity to pba:PSEBR_a5551)

Predicted SEED Role

"Protein phosphatase ImpM"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZM2 at UniProt or InterPro

Protein Sequence (217 amino acids)

>Pf6N2E2_4342 Protein phosphatase ImpM (Pseudomonas fluorescens FW300-N2E2)
MSTPGFYGKLASRGDFVSRGLPQSFIGPWDSWLAAGLLASQTSLGERWLDAYLVSPLWRF
MVAPGVCGPDAAVGVVMPSIDRVGRYFPLTVAVLLEPDADPASVVGGADEWFERVENLLL
STLSVEASFEAFNEQLETLGSPMHLPRTPSSRFASLHRFDATDPQRRMSALAEAACEGAS
LWWGQGSERIAPGLMRCQGLPAAADFAQFLLGQEGVV