Protein Info for Pf6N2E2_4328 in Pseudomonas fluorescens FW300-N2E2

Annotation: Uncharacterized protein ImpH/VasB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 TIGR03347: type VI secretion protein, VC_A0111 family" amino acids 4 to 302 (299 residues), 342.1 bits, see alignment E=1.3e-106 PF06996: T6SS_TssG" amino acids 4 to 302 (299 residues), 366.5 bits, see alignment E=5.7e-114

Best Hits

KEGG orthology group: K11895, type VI secretion system protein ImpH (inferred from 98% identity to pba:PSEBR_a5565)

Predicted SEED Role

"Uncharacterized protein ImpH/VasB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A3J7 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Pf6N2E2_4328 Uncharacterized protein ImpH/VasB (Pseudomonas fluorescens FW300-N2E2)
MHQEPWEYDFFQALRRIECESPELPRLGHSLRLADDPLRLGQQADCTFAPATLASVQPGG
DGTPARLEQFFFGLGGPNGPMPLHITEYVRERQRNNADSTSKRFLDVFHHRLLSLFYRAW
AEARPTVSHDRPDDDYWSARLAALSGRGMPSLLKQGLIPDTAKLHYSGHLSAQTRYPDGL
KAILSEYFGLPVEIEEYVGQWLELPERSRVGVSAHQLGVDFCLGRFVWDRQHKFRIRLGP
LKLVDYMGMLPGSQPFNELVAWVAEYLGHELDWDLNLVLAQPEVPALQLNGRFRLGFNTW
LGRPETDANDLILARHYAEQANTSQTSRSHEHG