Protein Info for Pf6N2E2_4326 in Pseudomonas fluorescens FW300-N2E2

Annotation: VgrG protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 TIGR03361: type VI secretion system Vgr family protein" amino acids 11 to 523 (513 residues), 682.6 bits, see alignment E=3.2e-209 TIGR01646: Rhs element Vgr protein" amino acids 24 to 506 (483 residues), 622.5 bits, see alignment E=5.9e-191 PF05954: Phage_GPD" amino acids 30 to 330 (301 residues), 372.1 bits, see alignment E=3e-115 PF04717: Phage_base_V" amino acids 386 to 453 (68 residues), 53.3 bits, see alignment E=4.3e-18 PF22178: Gp5_trimer_C" amino acids 470 to 576 (107 residues), 110.8 bits, see alignment E=6.3e-36

Best Hits

KEGG orthology group: None (inferred from 89% identity to pba:PSEBR_a5567)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A174 at UniProt or InterPro

Protein Sequence (646 amino acids)

>Pf6N2E2_4326 VgrG protein (Pseudomonas fluorescens FW300-N2E2)
MLFNQASRLAKITSPLGPEVLLLKDMGGGEELGRLFNYELQLHSLDNAIDLNQLLGKPMC
VSLQLDGGGERYFHGIVARCSQNVDQGQFASYQATLRPWLWLLTRTSDCRIFQNLTIPQI
IKQVFRDLGFSDFEDALSQTYREWEYCVQYRETSFDFVSRLMEQEGIYYFFRHEQGRHVL
VLADAYGAHTKAPGYGSVPYYPKNEQQRERDHIHDWHLAQEVQPGSLELNDYDFQRPSAR
IDVRAAMPRPHAAGDYPLYDYPGTYVQSQDGEHYARTRIEALQTQHEQVELSGNARGLGS
GHLFSLTGFSRQDQNREYLIVGARYYISQESGETGGGAPSAQFESSLTCIDAQQSYRPLP
ITHRPIVKGPQTALVVGPKGEEIWTDQFGRVKVHFYWDRHDQSNENSSCWIRVSQAWAGK
NWGSVQIPRIGQEVIVSFLEGDPDRPIVTGRVYNAEQTVPYALPANATQSGTKSRSSKGG
TPANFNEIRMEDKKGAEQLYIHAERNQDIVVEVDESHSVGHDRNKSIGHNETVRIGQDRL
RAVQRNDALLVGGAKSDSISTQYLVEAGSQIRLVCGKSVLEFNASGEINISGTAFNIYAS
GNGNIDTGGRLDLNSGGASEVDAKGKGIKGVIDAAVKAFFPAKAKH