Protein Info for Pf6N2E2_4309 in Pseudomonas fluorescens FW300-N2E2

Annotation: Outer membrane protein ImpK/VasF, OmpA/MotB domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 241 to 264 (24 residues), see Phobius details TIGR03349: type IV/VI secretion system protein, DotU family" amino acids 59 to 268 (210 residues), 218.7 bits, see alignment E=3.8e-69 PF09850: DotU" amino acids 60 to 262 (203 residues), 214.2 bits, see alignment E=7.6e-68

Best Hits

KEGG orthology group: K11892, type VI secretion system protein ImpK (inferred from 69% identity to pfo:Pfl01_5578)

Predicted SEED Role

"Outer membrane protein ImpK/VasF, OmpA/MotB domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZK54 at UniProt or InterPro

Protein Sequence (287 amino acids)

>Pf6N2E2_4309 Outer membrane protein ImpK/VasF, OmpA/MotB domain (Pseudomonas fluorescens FW300-N2E2)
MDKENPQDETTVLLDHHGQRPASGPLTNAAAPPRFEQLQERMIYAAHLPRSQAFNVSLNP
LVAAASGLLSQMVQLKHGREREDLQALKGELRRGLEQFEACALQDGVENSQLIAARYVLC
SAIDEAIVTTPWGRGGGWSQISLLSTFHNETFGGEKVFQLLERLSKNPIKHLSMLELLYL
CLSLGFEGKYRVQTRGTLELESRRDALYRLICQARGDIPRELSPRWEGYDGARRNPVRIV
PAWTVAVFTLVCLGVMYSSFAWVLGEQRRSVLQPYQLSESVAAQPLP