Protein Info for Pf6N2E2_4281 in Pseudomonas fluorescens FW300-N2E2

Annotation: Amino acid ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 61 to 85 (25 residues), see Phobius details amino acids 93 to 119 (27 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 204 to 222 (19 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 58 to 152 (95 residues), 88.2 bits, see alignment E=2.2e-29 PF00528: BPD_transp_1" amino acids 77 to 256 (180 residues), 82.7 bits, see alignment E=1.4e-27

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 99% identity to pba:PSEBR_a5590)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZL6 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Pf6N2E2_4281 Amino acid ABC transporter, permease protein (Pseudomonas fluorescens FW300-N2E2)
VAESRLQKIFGFRTRLYLTWAAMLVLFASFFLSFDLKFSIILDKLPNLLGVHLAPNGFLQ
GAVLTLFLCLCSIVASSLLGFITALARLSSSAVAFGIASFYASFFRGTPLLIQILLIYLG
LPQLGVVPGAIAAGIIALSLNYGAYLSEIFRAGILGVPHGQREASLALGLSETVIFWRVT
LPQAMRTIIPPTTNQFISMLKDSSLISVMGVWEVMFLAQSYGRSSYRYIEMLTTAAIIYW
LMSIALELIQARMERHYGKAYLKRS