Protein Info for Pf6N2E2_4262 in Pseudomonas fluorescens FW300-N2E2

Annotation: GTP cyclohydrolase I (EC 3.5.4.16) type 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF02649: GCHY-1" amino acids 12 to 265 (254 residues), 209.1 bits, see alignment E=4.4e-66

Best Hits

Swiss-Prot: 76% identical to GCH4_PSEF5: GTP cyclohydrolase FolE2 (folE2) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K09007, hypothetical protein (inferred from 89% identity to pba:PSEBR_a5608)

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 2" in subsystem Folate Biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.16

Use Curated BLAST to search for 3.5.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZF7 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Pf6N2E2_4262 GTP cyclohydrolase I (EC 3.5.4.16) type 2 (Pseudomonas fluorescens FW300-N2E2)
MCGIATPVLIDGQRLSATVDAGVSLDDSEARGIHMSRLYLALGLLEETPLSPALLRRILE
QFLDSHEGLSHAASLSVHTNLLLKRPALISPLAGWKGYPVSIEAQLKNTMFHVELKIQIP
YSSTCPCSAALARQLIQQQFVDDFANKKLEHAEILAWLGSSNGIVATPHSQRSMATLTLR
LDAAVDELPLQWFINQAEAALGTAVQTAVKRADEQAFALANGQNLMFCEDAARRLSTALA
RSSEITALDVRVVHAESLHAHDAVAQSRWTREAS