Protein Info for Pf6N2E2_4260 in Pseudomonas fluorescens FW300-N2E2

Annotation: Zinc ABC transporter, inner membrane permease protein ZnuB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 176 to 220 (45 residues), see Phobius details amino acids 231 to 255 (25 residues), see Phobius details amino acids 261 to 283 (23 residues), see Phobius details PF00950: ABC-3" amino acids 19 to 276 (258 residues), 171.5 bits, see alignment E=1.3e-54

Best Hits

KEGG orthology group: K02075, zinc/manganese transport system permease protein (inferred from 90% identity to pfo:Pfl01_5660)

Predicted SEED Role

"Zinc ABC transporter, inner membrane permease protein ZnuB" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A187 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Pf6N2E2_4260 Zinc ABC transporter, inner membrane permease protein ZnuB (Pseudomonas fluorescens FW300-N2E2)
VGGLMLAATHFWQPFQEFVFMRRALLGGLVLACSTAPLGVFLILRRMSLIGDAVAHGILP
GAALGFWFAGVSLPALTLGGLGAGLSMAGLAAWITRRTGLREDASLAAIYPISLAAGVLI
LGMAGKRLDLLHLLFGSALAVDGPTLTGMLWVSGASLVAMALIYRPLLFDTLDPLFLQTV
SRLGPLAHGVFLTLVVLNLVIGFQAIGALMVVGLMMLPAAASRFWSRRLPLLMLIAALLG
CLSVWLGLLLSFYYSLPSGPSIVLVAGVSYLLSVVFGPVHGLLRRPPLLTSQ