Protein Info for Pf6N2E2_4253 in Pseudomonas fluorescens FW300-N2E2

Annotation: HflC protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 45 to 64 (20 residues), see Phobius details PF01145: Band_7" amino acids 63 to 246 (184 residues), 111 bits, see alignment E=3.3e-36

Best Hits

KEGG orthology group: K04087, membrane protease subunit HflC [EC: 3.4.-.-] (inferred from 89% identity to pfo:Pfl01_5669)

Predicted SEED Role

"HflC protein" in subsystem Hfl operon

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GTN5 at UniProt or InterPro

Protein Sequence (346 amino acids)

>Pf6N2E2_4253 HflC protein (Pseudomonas fluorescens FW300-N2E2)
LSQSSSHDHHDHAGHDHGHPGHQHGHHHHHHGDPQQAGPFPWRRMGWAALLVAFAVAAAS
LVQVRSGEATVITRFGNPARVLLQPGLGWRWPAPFEAAIPVDLRLRTTSSGLQDVGTRDG
LRIIVQAYVAWQVQGDPENVQRFMRAVQNQPDEAARQIRTFVGSALETTAASFDLANLVN
TDASQVRIADFEAQLRQQIDQQLLTTYGVRVLQVGVERLTLPSVTLTATVDRMRAERETI
ATERTAIGKREAAQIRSAAERDARVLQADATVKAADIEAQSRVEAAEIYGRAYAGSPQLY
NLLRSLDTLGTIVSPGTKLILRTDAAPFRVLVDGPVSVDGKGGTQP