Protein Info for Pf6N2E2_4243 in Pseudomonas fluorescens FW300-N2E2

Annotation: UDP-glucose 4-epimerase (EC 5.1.3.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 6 to 110 (105 residues), 30.1 bits, E=5.3e-11
• PF16363: GDP_Man_Dehyd
  • amino acids 7 to 261 (255 residues), 176.4 bits, E=2.2e-55
• PF01370: Epimerase
  • amino acids 7 to 198 (192 residues), 142.3 bits, E=3.6e-45
• PF07993: NAD_binding_4
  • amino acids 25 to 129 (105 residues), 26.1 bits, E=9.3e-10

Best Hits

Swiss-Prot: 74% identical to RMD_PSEAE: GDP-6-deoxy-D-mannose reductase (rmd) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a5628)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

See A0A159ZZE2 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Pf6N2E2_4243 UDP-glucose 4-epimerase (EC 5.1.3.2) (Pseudomonas fluorescens FW300-N2E2)
VMPVAARYDLTDAKTLEGLWPEIPDAVIHLAGQTFVPEAFRDPARTLHINLLGTLNLLQA
LKARGFTGTFLYVSSGDVYGQISEDHLPITELQLPSPRNPYAVSKLSAELLSLQWGMSEG
WPVLVARPFNHIGPGQKDSFVIASAARQISRIKLGLQPARLQVGDIDVTRDFLDVGDVIS
AYLALLDKGAPGQVYNICSGREQSIRSLIEQLGDIAQVDVQLIQDPARLRRAEQRRVCGS
PAKLRQATGWTPETTTQQSLRAILSDWEIRVQQE