Protein Info for Pf6N2E2_4240 in Pseudomonas fluorescens FW300-N2E2

Annotation: O-antigen export system permease protein RfbD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 32 to 56 (25 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 110 to 137 (28 residues), see Phobius details amino acids 144 to 173 (30 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details PF01061: ABC2_membrane" amino acids 20 to 225 (206 residues), 86.8 bits, see alignment E=7.8e-29

Best Hits

KEGG orthology group: K09690, lipopolysaccharide transport system permease protein (inferred from 97% identity to pba:PSEBR_c2g117)

MetaCyc: 57% identical to O:8-antigen ABC transporter permease subunit (Escherichia coli O8)
TRANS-RXN-445 [EC: 7.5.2.14]

Predicted SEED Role

"O-antigen export system permease protein RfbD"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H3J7 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Pf6N2E2_4240 O-antigen export system permease protein RfbD (Pseudomonas fluorescens FW300-N2E2)
MLLSLHYSLWSYRGFILGSVKREFQSRYRNSLFGALWTVLNPLSMILVYTVIFSHIMRAR
LPGVEDGMAYSVYLCAGLLTWGLFAEITTRSQGMFLENANLLKKISFPRICLPVIVLFNA
GINFAIILGLFLGFLLITGRWPGITLLALVPLLALQVMFAAGLGMLLGILNVFFRDVGQL
FGICLQFWFWLTPIVYPMTILPPPIQQLLAFNPMTALMQSYQNLFLYNQWPVWSSLVPLL
VVGLLLCTLGLRMFRRRGGEMVDEL