Protein Info for Pf6N2E2_4233 in Pseudomonas fluorescens FW300-N2E2

Annotation: sulfatase domain protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 751 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 53 to 69 (17 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details PF00884: Sulfatase" amino acids 241 to 516 (276 residues), 145.3 bits, see alignment E=2.6e-46

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a5637)

Predicted SEED Role

"sulfatase domain protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZD4 at UniProt or InterPro

Protein Sequence (751 amino acids)

>Pf6N2E2_4233 sulfatase domain protein, putative (Pseudomonas fluorescens FW300-N2E2)
VLFNGLASTKGLFLVNILYRALNHPRATLIALIGCVLLVPMGLRLALGWSDPLGYLSDLG
IGGLLIVLLHRRPGWLAFPVLLAWSALTLASIELVSAVGRMPNPSDVHYLTDPQFVENSS
SGGFAHPWLAALQLSALVFWLVTQWTSRPRQAPRLLRHAWAVPVLLLLGHGALQAWRPSE
ADQWNVFNLPHQLITAGIAAGQDQARQWLDGDAVDPAPPMEGLTRLDLDGNRLLAEPGRA
RNVLVIALEGIPGAYVGANRQALKSSYQENLMPHLSAWAERGMNTPDYVLHSHQTIRGLY
AMLCGDYDKLDNGTPKGVEMLNQTQRNQACLPAQLRQNGFSTHFLQGAGLRFMAKDRIMP
HIGFDTTLGMEWFTRPAYLEFPWGMDDKTFFEGALDYVGQLQQADKPWMLTLLTVGTHQP
YSAPDDYLQRYDTAKQAAVGYLDDALENFLAGLERQGILDNTLVVITSDESHGIDDVRLA
SSWGFNLTLAPEPLPRIKSGTYGHVDLTASILDYFGFTVPTSLSGRSMFRDYPTGREIMS
FTNGKLRYHDGKGTFTECDFLQHCRYYTSEGFIADRATYGGQYSGQRARLIGARATALDQ
TLLRTPLNQHYQFGSTDKIPLPAQVTNDWTDNLIGAQYLEMPKGSQTRVSLTIRAVDADH
AAYISLKAKEFEQDVSMDLPTDVAVTPDQPLVMNLRFDNPQQRKAFSFHLLGHGVGAIEI
SDFSVVTELPDQTDQPQYLDDMQEDREAQSS