Protein Info for Pf6N2E2_4232 in Pseudomonas fluorescens FW300-N2E2

Annotation: Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01118: Semialdhyde_dh" amino acids 3 to 109 (107 residues), 76.9 bits, see alignment E=1.8e-25 PF02774: Semialdhyde_dhC" amino acids 131 to 313 (183 residues), 141.9 bits, see alignment E=2.6e-45

Best Hits

Swiss-Prot: 38% identical to DHAS_AQUAE: Aspartate-semialdehyde dehydrogenase (asd) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K00133, aspartate-semialdehyde dehydrogenase [EC: 1.2.1.11] (inferred from 96% identity to pba:PSEBR_a5638)

Predicted SEED Role

"Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 1.2.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.11

Use Curated BLAST to search for 1.2.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZH7 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Pf6N2E2_4232 Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) (Pseudomonas fluorescens FW300-N2E2)
MKKVAVVGCTGAVGMTMLQLLENTDYEVVCMASGRSAGKRLKVGQVEHLIEAFSVEGCAS
CDIVFLCVSGAFALEYGERLAENAYVIDNSSAFRYHPAIPLLVPPINGQRYMGEKLIANP
NCSSAIALMVLGPLHQAFGLESAIISTYQAASGAGQPAMLELREKAKSFSDYGDRDDSEH
FAHNLAFNVIPQVDSFEANGYTREEMKVVWELRKVLDEPTLAISTTAVRVPTLRSHAESL
SLRFNTPIQSLEQVRELLRSAPGVEVVDEPEFGAYPMPMTSTYKHAVEVGRIRYNLIYGE
HGLDLFISGDQLLRGAALNAFEIMQLIKS