Protein Info for Pf6N2E2_4231 in Pseudomonas fluorescens FW300-N2E2

Annotation: rarD protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 10 to 28 (19 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details TIGR00688: protein RarD" amino acids 10 to 264 (255 residues), 149.1 bits, see alignment E=8.2e-48 PF00892: EamA" amino acids 10 to 144 (135 residues), 45.4 bits, see alignment E=5.2e-16

Best Hits

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 35% identity to maq:Maqu_0334)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A167 at UniProt or InterPro

Protein Sequence (309 amino acids)

>Pf6N2E2_4231 rarD protein (Pseudomonas fluorescens FW300-N2E2)
MTARNESGQGVAFGLGATLLWGSYPLWYKPLAGLDAYHLLSWRVVFAELFLVALVLLTAR
VSTLRSTLKTVRPVNVLTVSAVLGLWWLMYIYAIMTGRVLEVAFGYFLSPIMSMLVSRLV
FKERLSVLQTWAIFLAVAGVTLMAFELLNLHSFPWIALVIGFCYSFYGLFKKKVPGDPVV
IQTLEIAVLLPFAAVFLLLAQAHGVGHQFLQSGTRDLLLVATGLITVLPLWWYSLAAKQL
SMIALGFLQFVPPICNFLLAAFVYGEPVSALKLAAFSFIWLALALFTWNSIRAQRAAAAA
NVSAQLRTA