Protein Info for Pf6N2E2_4229 in Pseudomonas fluorescens FW300-N2E2

Annotation: GDP-mannose pyrophosphatase YffH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 PF27456: NudK_N" amino acids 10 to 48 (39 residues), 65.9 bits, see alignment 2e-22 TIGR00052: nudix-type nucleoside diphosphatase, YffH/AdpP family" amino acids 13 to 193 (181 residues), 162.1 bits, see alignment E=5.8e-52 PF00293: NUDIX" amino acids 51 to 178 (128 residues), 39.8 bits, see alignment E=4.6e-14

Best Hits

Swiss-Prot: 57% identical to NUDK_SALTI: GDP-mannose pyrophosphatase NudK (nudK) from Salmonella typhi

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a5640)

MetaCyc: 55% identical to GDP-mannose hydrolase (Escherichia coli K-12 substr. MG1655)
3.6.1.-

Predicted SEED Role

"GDP-mannose pyrophosphatase YffH" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A3B9 at UniProt or InterPro

Protein Sequence (198 amino acids)

>Pf6N2E2_4229 GDP-mannose pyrophosphatase YffH (Pseudomonas fluorescens FW300-N2E2)
MTQAIGIKDRVRIKHVEVLSDDWYVLRKTTYDYLGRNGQWRELTRETYDRGNGATILLYS
KAKQTVVLTRQFRFPAFVNGHDDLLIETCAGLLDNDDPHTCIRKETQEETGYIIQDVRKV
FDAFMSPGSVTERVHFFVGEYFDEDKQHAGGGLEAEGEEIEVLEMSLDQALDMIERGEIC
DGKTIMLLQYAKLHRLLD