Protein Info for Pf6N2E2_4204 in Pseudomonas fluorescens FW300-N2E2

Annotation: rRNA small subunit 7-methylguanosine (m7G) methyltransferase GidB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 PF02527: GidB" amino acids 25 to 204 (180 residues), 212.9 bits, see alignment E=2.6e-67 TIGR00138: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG" amino acids 31 to 208 (178 residues), 181.5 bits, see alignment E=6.4e-58 PF05175: MTS" amino acids 56 to 143 (88 residues), 23.5 bits, see alignment E=3.9e-09

Best Hits

Swiss-Prot: 96% identical to RSMG_PSEPF: Ribosomal RNA small subunit methyltransferase G (rsmG) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03501, ribosomal RNA small subunit methyltransferase G [EC: 2.1.1.170] (inferred from 99% identity to pba:PSEBR_a5660)

MetaCyc: 47% identical to 16S rRNA m7G527 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11578 [EC: 2.1.1.170]

Predicted SEED Role

"rRNA small subunit 7-methylguanosine (m7G) methyltransferase GidB"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.170

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZB0 at UniProt or InterPro

Protein Sequence (211 amino acids)

>Pf6N2E2_4204 rRNA small subunit 7-methylguanosine (m7G) methyltransferase GidB (Pseudomonas fluorescens FW300-N2E2)
MVTSQHAEELSTGARQLGVNLTEAQHAQLLGYLALLIKWNKAYNLTAVRDPDEMVSRHLL
DSLSVMSFIENGRWLDVGSGGGMPGIPLAILFPDSQVTCLDSNGKKTRFLTQVKLELKLD
NLQVIHSRVEAFQPAQPFNGIISRAFSSMENFSNWTRHLGDADTRWLAMKGVHPADELVA
LPADFHLDSEHALAVPGCQGQRHLLILRRTA