Protein Info for Pf6N2E2_4188 in Pseudomonas fluorescens FW300-N2E2

Annotation: DNA-3-methyladenine glycosylase (EC 3.2.2.20)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details TIGR00624: DNA-3-methyladenine glycosylase I" amino acids 1 to 165 (165 residues), 283.2 bits, see alignment E=3.6e-89 PF03352: Adenine_glyco" amino acids 2 to 164 (163 residues), 227.8 bits, see alignment E=4.4e-72

Best Hits

Swiss-Prot: 52% identical to 3MGA_HAEIN: DNA-3-methyladenine glycosylase (tag) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01246, DNA-3-methyladenine glycosylase I [EC: 3.2.2.20] (inferred from 98% identity to pba:PSEBR_c2g1)

MetaCyc: 50% identical to 3-methyl-adenine DNA glycosylase I, constitutive (Escherichia coli K-12 substr. MG1655)
DNA-3-methyladenine glycosylase I. [EC: 3.2.2.20]

Predicted SEED Role

"DNA-3-methyladenine glycosylase (EC 3.2.2.20)" in subsystem DNA Repair Base Excision (EC 3.2.2.20)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.20

Use Curated BLAST to search for 3.2.2.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A387 at UniProt or InterPro

Protein Sequence (172 amino acids)

>Pf6N2E2_4188 DNA-3-methyladenine glycosylase (EC 3.2.2.20) (Pseudomonas fluorescens FW300-N2E2)
MAYHDQEWGTPLRDAQGLFELLLLEGFQAGLSWITVLRKRERYREVLYGFDVQRVAQMSD
AEIDELMLDPGIIRNRLKLKAARRNAQAWLALEDPVAFLWSFVGDKPIINHFKDRSEVPA
ITPEALAMSKGLKKAGFTFVGPTICYALMQASGMVMDHTQDCDRYAELANGG