Protein Info for Pf6N2E2_4153 in Pseudomonas fluorescens FW300-N2E2

Annotation: Sensory box histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 169 to 191 (23 residues), see Phobius details PF16767: KinB_sensor" amino acids 39 to 160 (122 residues), 89.4 bits, see alignment E=1e-28 PF00672: HAMP" amino acids 194 to 245 (52 residues), 41.2 bits, see alignment 6.9e-14 TIGR00229: PAS domain S-box protein" amino acids 258 to 374 (117 residues), 40.9 bits, see alignment E=1e-14 PF13188: PAS_8" amino acids 259 to 314 (56 residues), 28.2 bits, see alignment 5.3e-10 PF00989: PAS" amino acids 260 to 367 (108 residues), 32.2 bits, see alignment E=3.8e-11 PF08448: PAS_4" amino acids 265 to 372 (108 residues), 40.6 bits, see alignment E=1.1e-13 PF00512: HisKA" amino acids 377 to 444 (68 residues), 54.5 bits, see alignment E=4e-18 PF02518: HATPase_c" amino acids 491 to 594 (104 residues), 98.6 bits, see alignment E=1.2e-31

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a48)

Predicted SEED Role

"Sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZB1 at UniProt or InterPro

Protein Sequence (596 amino acids)

>Pf6N2E2_4153 Sensory box histidine kinase (Pseudomonas fluorescens FW300-N2E2)
MKLAMKLRTRLFLSISALITVALLGLVLGLVSVMQMANTQEQSVRDNFILLDLGLKLRQT
LGDQLMIMLDDKPDLAMLEASKQQYLALIDEGIAHEQGLDEAAVSFSRAKADYIEFFEAF
TASRQQPSQLANIKDLTEKFNVLRNGLIEGYRRALTNISETQDRARERAMWISGLLGLVG
FAVLIIGFITAHGIARRFGAPIEVLAAAADDIGQGNFEVTLPVSSAAELNLLTRRFGVMA
EALREHQATNVDELLAGQQRLQAVLDSIDDGLLMIDRKGQLEHLNPVAQRQLGWDEERLG
QGLGEALGRLELDEELHLVLRGGSLERAPEDLSVEVDGESRVLTYSLTPVSHTQGHILGA
VMVLHDVTEQRAFERVRSEFVLRASHELRTPVTGMHMAFGLLQERLHFSEESREADLLNT
VTEEMQRLMQLINDLLNFSRYQNGLQKLTLAPCSIDDLLEAARLRFAEQAQTKGIELLVA
IQGPLPRLHADAAQLDRVLDNLIDNAMRHTAENGQIRLQARRHGERVIISVEDNGEGIAY
GQQGRIFEPFVQVGRKKGGAGLGLALCKEIVQLHGGRMGVYSRPGQGTQFYMALAV