Protein Info for Pf6N2E2_4150 in Pseudomonas fluorescens FW300-N2E2

Annotation: probable exported protein YPO0432

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 54 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 49 (21 residues), see Phobius details PF07043: DUF1328" amino acids 6 to 43 (38 residues), 61.9 bits, see alignment E=2.9e-21

Best Hits

Swiss-Prot: 100% identical to Y044_PSEPF: UPF0391 membrane protein Pfl01_0044 (Pfl01_0044) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: None (inferred from 94% identity to psp:PSPPH_0249)

Predicted SEED Role

"probable exported protein YPO0432"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (54 amino acids)

>Pf6N2E2_4150 probable exported protein YPO0432 (Pseudomonas fluorescens FW300-N2E2)
MLSWAITFLIIAIIAAVLGFGGIAGTATGIAKILFVVFLVMFIASFFFGRRGRG