Protein Info for Pf6N2E2_4127 in Pseudomonas fluorescens FW300-N2E2

Annotation: Quinone oxidoreductase (EC 1.6.5.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF08240: ADH_N" amino acids 27 to 111 (85 residues), 58 bits, see alignment E=1.6e-19 PF00107: ADH_zinc_N" amino acids 152 to 256 (105 residues), 88.9 bits, see alignment E=4.1e-29 PF13602: ADH_zinc_N_2" amino acids 185 to 323 (139 residues), 65.8 bits, see alignment E=1.1e-21

Best Hits

Swiss-Prot: 79% identical to QOR_PSEAE: Quinone oxidoreductase (qor) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a70)

MetaCyc: 43% identical to 2-haloacrylate reductase (Burkholderia sp. WS)
RXN-14536 [EC: 1.3.1.103]

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.3.1.103 or 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A341 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Pf6N2E2_4127 Quinone oxidoreductase (EC 1.6.5.5) (Pseudomonas fluorescens FW300-N2E2)
MAKRIQFSSHGGPEVLEYVDYSPAEPGPQQVRVSNKAIGLNFIDTYYRSGLYPPPALPSG
LGAEGAGVVEAVGSDVTRFKVGDRVAYGSGPLGAYSDVHVLPEANLVHLPESISFEQAAG
VMLKGLTVQYLLRQTYELKGGETILFHAAAGGVGSLACQWAKALGVKLIGTVSSPEKAAI
AKSHGAWETIDYSKENVAQRVLELTGGKKVPVVYDGVGKDTWLTSLDSVAPRGLVVSFGN
ASGAVEGVNLGILAAKGSLYVTRPTLATYANNAENLQRMADELFGMISSGKIKVDINQRY
PLAEAAKAQAELSARRTTGSTILLP