Protein Info for Pf6N2E2_4126 in Pseudomonas fluorescens FW300-N2E2

Annotation: TsaC protein (YrdC domain) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 TIGR00057: tRNA threonylcarbamoyl adenosine modification protein, Sua5/YciO/YrdC/YwlC family" amino acids 6 to 182 (177 residues), 126 bits, see alignment E=5.5e-41 PF01300: Sua5_yciO_yrdC" amino acids 14 to 182 (169 residues), 164.1 bits, see alignment E=1.2e-52

Best Hits

Swiss-Prot: 90% identical to TSAC_PSEF5: Threonylcarbamoyl-AMP synthase (tsaC) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K07566, putative translation factor (inferred from 100% identity to pba:PSEBR_a71)

Predicted SEED Role

"TsaC protein (YrdC domain) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A240 at UniProt or InterPro

Protein Sequence (185 amino acids)

>Pf6N2E2_4126 TsaC protein (YrdC domain) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA (Pseudomonas fluorescens FW300-N2E2)
MVNSWRVQQAAREIRAGAVIAYPTEAVWGLGCDPWNEEAVERLLAIKSRLPDKGLILVAD
NIHQFDFLFEDFPETWMDRMASTWPGPNTWLVPHQNLLPEWITGVHDTVALRVSDHPTVR
DLCSLVGPLVSTSANPQGRPAARTRIRVEQYFRGQIDLVLGGNLGGRKNPSVIRDLATGK
VVRPD