Protein Info for Pf6N2E2_4120 in Pseudomonas fluorescens FW300-N2E2

Annotation: Trk system potassium uptake protein TrkA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF02254: TrkA_N" amino acids 3 to 124 (122 residues), 91.7 bits, see alignment E=2.1e-29 amino acids 234 to 349 (116 residues), 92.2 bits, see alignment E=1.5e-29 PF02080: TrkA_C" amino acids 154 to 223 (70 residues), 50.5 bits, see alignment E=8e-17 amino acids 389 to 450 (62 residues), 42.2 bits, see alignment E=3e-14 PF13241: NAD_binding_7" amino acids 230 to 337 (108 residues), 22.4 bits, see alignment E=7.9e-08

Best Hits

Swiss-Prot: 74% identical to TRKA_HALED: Trk system potassium uptake protein TrkA (trkA) from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

KEGG orthology group: K03499, trk system potassium uptake protein TrkA (inferred from 99% identity to pba:PSEBR_a77)

Predicted SEED Role

"Trk system potassium uptake protein TrkA" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZ87 at UniProt or InterPro

Protein Sequence (457 amino acids)

>Pf6N2E2_4120 Trk system potassium uptake protein TrkA (Pseudomonas fluorescens FW300-N2E2)
MKIIILGAGQVGGSLAEHLASEANDITVVDTNGERLRDLGDRLDIRTVQGRGSLPTVLRQ
AGADDADMLVAVTNSDETNMVACQVAHTLFHTPTKIARVREAAYLTRADLFDNEAIPVDV
LISPEQVVTNYIKRLIEHPGALQVIDFAEGKAQLVAVKAYYGGPLVGQQLRQLREHMPNV
DTRVAAIFRRDRPILPQGDTVIEADDEVFFIAAKANIRAVMSEMRRLDENYKRIVIAGGG
QIGERLAEAIESRYQVKIIEMNPARCRYLSDTLDSTVVLQGSASDRDLLLEENIADADIF
LALTNDDEANIMSSLLAKRLGARKVMTIINNPAYVDLIQGGDIDIAISPQLATIGTLLAH
VRRGDIVSVHSLRRGAAEAIEAIAHGDAKSSKVIGKAIRDIGLPPGTTIGAIIRDEEVLI
AHDDTTIQTGDHVILFLVDKKHIRDVEKLFHVGLSFF