Protein Info for Pf6N2E2_4101 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cytochrome c oxidase polypeptide III (EC 1.9.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 46 to 69 (24 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 125 to 138 (14 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 229 to 255 (27 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details PF00510: COX3" amino acids 7 to 117 (111 residues), 42.3 bits, see alignment E=4.5e-15 amino acids 154 to 294 (141 residues), 150.8 bits, see alignment E=3.3e-48

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 97% identity to pba:PSEBR_a92)

MetaCyc: 78% identical to cytochrome c oxidase subunit 3 (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GTM2 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Pf6N2E2_4101 Cytochrome c oxidase polypeptide III (EC 1.9.3.1) (Pseudomonas fluorescens FW300-N2E2)
MATHEHYYVPAQSKWPIIATVGMFVTVYGLATWFNDLKAARPDSHGPLIFFVGGLLLAYM
LFGWFGAVIKESRAGLYSAQLDRSFRWGMSWFIFSEVMFFIAFFGALFYVRMISAPGLAG
EGTKGLSHMLWPSFEFAWPLLNNPDPKLFPAPKDVISPWGLPLLNTVLLVSSSVTVTIAH
HALKKGHRGALKLWLAITVLLGCAFLGFQAEEYIHAYKELGLTLGSGVYGATFFMLTGFH
GAHVTIGTIILFVMLMRIMRGHFDNEHQFGFEAASWYWHFVDVVWIGLFVFVYVL