Protein Info for Pf6N2E2_409 in Pseudomonas fluorescens FW300-N2E2

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 164 to 181 (18 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details amino acids 281 to 303 (23 residues), see Phobius details PF00892: EamA" amino acids 22 to 152 (131 residues), 75.4 bits, see alignment E=2.8e-25 amino acids 166 to 297 (132 residues), 71.3 bits, see alignment E=4.9e-24

Best Hits

KEGG orthology group: None (inferred from 90% identity to pba:PSEBR_a3454)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZR65 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Pf6N2E2_409 Permease of the drug/metabolite transporter (DMT) superfamily (Pseudomonas fluorescens FW300-N2E2)
METRCVPFEGLKNPSRPRVKVILATTFVILCWAYSPVGIRIGLQAYEPGQLALMRFLIAS
VFMAVVAMAKGISWPRLGDLPLLAVLGFFAVSLHHIALNYGQRGVSAAAASVLAQSTPLF
STLLAHFVFKERVGAWQWGCVLCGLLGAAVVVTGDRGLGDMDAHGLLILLAALSWSVYFA
LQKHHTHRYEGLTLVCYTVWSGTLLLFIFAPGMLSAARQASASVNLAVLVLGIFPSALAY
LAWAYVLAHSDVSRASMALYLIPPTAMLMACLVLAERPATMVIVGAVIVLASVLALNFGP
VSVAKVG