Protein Info for Pf6N2E2_4082 in Pseudomonas fluorescens FW300-N2E2

Annotation: Phosphoribosylaminoimidazole carboxylase catalytic subunit (EC 4.1.1.21)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 TIGR01162: phosphoribosylaminoimidazole carboxylase, catalytic subunit" amino acids 1 to 135 (135 residues), 189.2 bits, see alignment E=1.6e-60 PF00731: AIRC" amino acids 1 to 129 (129 residues), 180.6 bits, see alignment E=7e-58

Best Hits

Swiss-Prot: 91% identical to PURE_PSEAE: N5-carboxyaminoimidazole ribonucleotide mutase (purE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01588, 5-(carboxyamino)imidazole ribonucleotide mutase [EC: 5.4.99.18] (inferred from 97% identity to pfo:Pfl01_5622)

MetaCyc: 69% identical to N5-carboxyaminoimidazole ribonucleotide mutase (Escherichia coli K-12 substr. MG1655)
5-(carboxyamino)imidazole ribonucleotide mutase. [EC: 5.4.99.18]

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase catalytic subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 5.4.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0D9AIE4 at UniProt or InterPro

Protein Sequence (140 amino acids)

>Pf6N2E2_4082 Phosphoribosylaminoimidazole carboxylase catalytic subunit (EC 4.1.1.21) (Pseudomonas fluorescens FW300-N2E2)
MLEKLGIPYEVKVVSAHRTPDLLFQYAEEAEARGIEVIIAGAGGAAHLPGMCAAKTHLPV
LGVPVQSSMLSGVDSLLSIVQMPAGIPVATLAIGKAGAINAALLSASILGAKHPQFHTVL
KKFRAEQTDSVLDNPDPRIA