Protein Info for Pf6N2E2_4077 in Pseudomonas fluorescens FW300-N2E2
Annotation: cytosolic long-chain acyl-CoA thioester hydrolase family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 45% identical to YCIA_ECOLI: Acyl-CoA thioester hydrolase YciA (yciA) from Escherichia coli (strain K12)
KEGG orthology group: K10806, acyl-CoA thioesterase YciA [EC: 3.1.2.-] (inferred from 98% identity to pfs:PFLU6050)MetaCyc: 45% identical to acyl-CoA thioesterase YciA (Escherichia coli K-12 substr. MG1655)
Acyl-CoA hydrolase. [EC: 3.1.2.20]
Predicted SEED Role
"cytosolic long-chain acyl-CoA thioester hydrolase family protein" in subsystem Serine-glyoxylate cycle
MetaCyc Pathways
- palmitoleate biosynthesis IV (fungi and animals) (1/2 steps found)
- firefly bioluminescence (2/14 steps found)
- jasmonic acid biosynthesis (4/19 steps found)
KEGG Metabolic Maps
- Benzoate degradation via CoA ligation
- Biosynthesis of plant hormones
- Biosynthesis of unsaturated fatty acids
- Fatty acid biosynthesis
- Limonene and pinene degradation
- Ubiquinone and menaquinone biosynthesis
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 3.1.2.-
Use Curated BLAST to search for 3.1.2.- or 3.1.2.20
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0D0SYW8 at UniProt or InterPro
Protein Sequence (134 amino acids)
>Pf6N2E2_4077 cytosolic long-chain acyl-CoA thioester hydrolase family protein (Pseudomonas fluorescens FW300-N2E2) MIELEQEDPIPQGDLALQITALPRETNGFGDIFGGWLVSQMDLAGTAMASKVAGGRVATV AIDRMAFLVPVAVGAQLSFYTQALEIGRSSIQMMVEVWSDDPLSSEWRKVTEAVFVFVAI DGSGRTRSVPPRAR