Protein Info for Pf6N2E2_4074 in Pseudomonas fluorescens FW300-N2E2

Annotation: Phosphate transport system permease protein PstC (TC 3.A.1.7.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 763 transmembrane" amino acids 43 to 68 (26 residues), see Phobius details amino acids 467 to 489 (23 residues), see Phobius details amino acids 502 to 525 (24 residues), see Phobius details amino acids 531 to 551 (21 residues), see Phobius details amino acids 567 to 588 (22 residues), see Phobius details amino acids 614 to 633 (20 residues), see Phobius details amino acids 662 to 683 (22 residues), see Phobius details amino acids 728 to 749 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 511 to 758 (248 residues), 28.1 bits, see alignment E=8e-11

Best Hits

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 99% identity to pba:PSEBR_a119)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A2Z9 at UniProt or InterPro

Protein Sequence (763 amino acids)

>Pf6N2E2_4074 Phosphate transport system permease protein PstC (TC 3.A.1.7.1) (Pseudomonas fluorescens FW300-N2E2)
VRMNDLANSTMTTTSPPKRIDFNTPELQRKRRIRALKDRLTRWYVLVGGLAVLAAITLIF
FFLAYVVLPLFQGADLTAKDTITPAWMQDAGKPLMISIEEQNQVAMRVSDKGQALFFDIS
SGAELRRIDLPIPAGASVTAIGEDQPGSPLVAIGLSNGQALVFRHTYKVSYPDGKKTISP
AVEYPYGETPIALNEQGAALEHVSLNATDSTLLLAGSSGAQLQVLSLTSEENMMTGEVTS
EQTRIDLPQMTEPVKNIFVDPRQQWLYVVNGRAQADVFSLRDKSLNGRYKLLENADAQVT
AATQLVGGISLIIGDSKGGLAQWFMARDPDGELRFKQIRTFQMGTTPIVEISAEERRKGF
VALDAAGKLGVFHSTAHRTLLVDQVVDGQGLFGMSPRANRLIVEQGGKLQPLTLDNPHPE
VSWSALWSKVWYENYDEPKYVWQSTAANTDFEPKMSLSPLTFGTLKAAFYAMLLAAPLAI
AAAIYTAYFMAPGMRRKVKPVIELMEAMPTVILGFFAGLFLAPYVEGHLPGIFSLLMLLP
IGILVAGFVFSRLPESIRLRVPDGWESALLIPVILFVGWLSLYMSPYMEAWFFGGDMRMW
ISHDLGITYDQRNALVVGLAMGFAVIPNIYSIAEDAVFSVPRGLTLGSLALGATPWQTMT
RVVILTASPGIFSALMIGMGRAVGETMIVLMATGNTPVMEMNLFEGLRTLAANVAVEMPE
SEVGGSHYRVLFLSALVLLLFTFVMNTLAELIRQRLRKKYSSL