Protein Info for Pf6N2E2_4065 in Pseudomonas fluorescens FW300-N2E2

Annotation: Orf21; putative lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF03640: Lipoprotein_15" amino acids 31 to 71 (41 residues), 49.8 bits, see alignment E=9.3e-18 amino acids 83 to 127 (45 residues), 55.5 bits, see alignment E=1.6e-19

Best Hits

KEGG orthology group: None (inferred from 73% identity to pfl:PFL_6107)

Predicted SEED Role

"Orf21; putative lipoprotein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H4D1 at UniProt or InterPro

Protein Sequence (129 amino acids)

>Pf6N2E2_4065 Orf21; putative lipoprotein (Pseudomonas fluorescens FW300-N2E2)
MTYLTQSIRALAVTAALALPTWAFAAEPAMVDKEKGILTDHQNMTLYTFAKDSGGKSMCN
DKCAANWPPLMAEESDKSMGKWTVITRADRKKQWAYDGKPLYTFVKDTKAGDMTGDGLMD
GAWKVAKPH