Protein Info for Pf6N2E2_4063 in Pseudomonas fluorescens FW300-N2E2

Annotation: Chorismate--pyruvate lyase (EC 4.1.3.40)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04345: Chor_lyase
  • amino acids 39 to 194 (156 residues), 187.8 bits, E=1.2e-59
• PF01947: Rv2949c-like
  • amino acids 47 to 190 (144 residues), 23.2 bits, E=5.9e-09

Best Hits

Swiss-Prot: 80% identical to UBIC2_PSEPF: Probable chorismate pyruvate-lyase 2 (ubiC2) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03181, chorismate--pyruvate lyase [EC: 4.1.3.40] (inferred from 99% identity to pba:PSEBR_a131)

Predicted SEED Role

"Chorismate--pyruvate lyase (EC 4.1.3.40)" in subsystem Ubiquinone Biosynthesis (EC 4.1.3.40)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (11/12 steps found)
• superpathway of chorismate metabolism (43/59 steps found)
• 4-hydroxybenzoate biosynthesis II (bacteria) (1/1 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (5/9 steps found)
• polybrominated phenols biosynthesis (1/4 steps found)
• spongiadioxin C biosynthesis (2/7 steps found)
• polybrominated dihydroxylated diphenyl ethers biosynthesis (2/8 steps found)
• p-HBAD biosynthesis (1/9 steps found)
• tetrahydromethanopterin biosynthesis (3/14 steps found)
• superpathway of polybrominated aromatic compound biosynthesis (2/20 steps found)
• phenolphthiocerol biosynthesis (1/23 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.40

Sequence Analysis Tools

See A0A165ZX06 at UniProt or InterPro

Protein Sequence (201 amino acids)

>Pf6N2E2_4063 Chorismate--pyruvate lyase (EC 4.1.3.40) (Pseudomonas fluorescens FW300-N2E2)
MVSSRPHLLPIKTLVPHTNSIFPTLQWLPQPLLSPRPDAGVLDWLFDEGSLTRRLTRLSD
GHFSVTPLFEGWQPLRADECAALDLAEGSEGWVREVYLRGHDQPWVFARSVAARSALHGD
GLQMDELGSRSLGELLFCDQAFQRRAIEVCHYPDAGLPEEVRASGLWGRRSRFDRGALSV
LVAEIFLPRLWTVARAYSENC