Protein Info for Pf6N2E2_4028 in Pseudomonas fluorescens FW300-N2E2

Annotation: Biofilm PGA synthesis auxiliary protein PgaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details TIGR03940: poly-beta-1,6-N-acetyl-D-glucosamine biosynthesis protein PgaD" amino acids 3 to 134 (132 residues), 67.1 bits, see alignment E=7.9e-23 PF13994: PgaD" amino acids 7 to 131 (125 residues), 67 bits, see alignment E=9.7e-23

Best Hits

KEGG orthology group: K11937, biofilm PGA synthesis protein PgaD (inferred from 96% identity to pba:PSEBR_a163)

Predicted SEED Role

"Biofilm PGA synthesis auxiliary protein PgaD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0I6 at UniProt or InterPro

Protein Sequence (168 amino acids)

>Pf6N2E2_4028 Biofilm PGA synthesis auxiliary protein PgaD (Pseudomonas fluorescens FW300-N2E2)
MKIIRTRQRPFLVLIDAFFTVLAWVGLLYLLVNGLWPLFASQAGPRPGGALFDTLGTLQV
YGWIALVNAVLLITWARYQQRKSRSFAQRRSPAPVVNDQGLSASFKLTDERLDTLRQPGS
KTIHNNQDGDISHVVPHFHLLSPDLQPPPLAPLERPGVIHLPADHSVH