Protein Info for Pf6N2E2_4024 in Pseudomonas fluorescens FW300-N2E2

Annotation: L-Proline/Glycine betaine transporter ProP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 120 to 146 (27 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 246 to 271 (26 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 340 to 363 (24 residues), see Phobius details amino acids 375 to 395 (21 residues), see Phobius details amino acids 401 to 421 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 22 to 233 (212 residues), 85.1 bits, see alignment E=5.1e-28 PF07690: MFS_1" amino acids 62 to 389 (328 residues), 121 bits, see alignment E=5.7e-39

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a167)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZIY9 at UniProt or InterPro

Protein Sequence (437 amino acids)

>Pf6N2E2_4024 L-Proline/Glycine betaine transporter ProP (Pseudomonas fluorescens FW300-N2E2)
MTAIPVLPGDRFSRSDYKTLGLAALGGALEIYDFIIFVFFALTLSQLFFPPEMPDWLRLL
QSFGIFATGYLARPLGGILMAHFADRLGRKRVFSLSILMMALPCLLIGVMPTYAQIGYFA
PLLLLALRILQGAAVGGEVPSAWVFVAEHAPLHHRGYALGFLQAGLTFGYLLGALTATAL
ARIYTPAEILDYAWRLPFLLGGVFGVIGVWLRRWLSETPIFMALQANREGAAELPLRTVL
RDHRQALLPAAILTCVLTSAVVVFVVITPTVMQKSFGMTPSHTFALSSLGIVFLNIGCVL
AGLIVDRIGAWRTVMLYSLLLPVGIAVLYASLISGSAWLGLAYAVAGLGCGVVGAVPSVM
VSLFPPKIRVSGISLTYNIAYALWASMTPLMLIALVPWSPWVCVGYCVVMGAVGVAASAY
FPGRHGKAAQPSLACES