Protein Info for Pf6N2E2_4004 in Pseudomonas fluorescens FW300-N2E2

Annotation: Sulfate transport system permease protein CysT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 transmembrane" amino acids 33 to 56 (24 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 209 to 232 (24 residues), see Phobius details TIGR02139: sulfate ABC transporter, permease protein CysT" amino acids 1 to 237 (237 residues), 394.2 bits, see alignment E=3.1e-122 TIGR00969: sulfate ABC transporter, permease protein" amino acids 1 to 235 (235 residues), 296.4 bits, see alignment E=2.1e-92 PF00528: BPD_transp_1" amino acids 42 to 236 (195 residues), 79.8 bits, see alignment E=1.1e-26

Best Hits

Swiss-Prot: 53% identical to CYST_SYNY3: Sulfate transport system permease protein CysT (cysT) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02046, sulfate transport system permease protein (inferred from 100% identity to pba:PSEBR_a183)

MetaCyc: 49% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysU (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysT" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0H1 at UniProt or InterPro

Protein Sequence (239 amino acids)

>Pf6N2E2_4004 Sulfate transport system permease protein CysT (Pseudomonas fluorescens FW300-N2E2)
MFVHAAQLTWEQFWAIISAPRVLAALKLSFGTALYAAIINGVIGTLLAWVLVRYTFPGRK
IIDAMMDLPFALPTAVAGIALTALYAPTGLVGQFATDLGFKIAYTPLGITLALTFVTLPF
VVRTVQPVLADIPREVEEAAACLGAKPWQVFRHILVPALLPAWLTGFALAFARGVGEYGS
VIFIAGNMPMKTEILPLLIMVKLDQYDYTGATSIGVLMLVVSFVLLLLINLLQRRIETP