Protein Info for Pf6N2E2_3995 in Pseudomonas fluorescens FW300-N2E2

Annotation: Fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 68 to 85 (18 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details PF00487: FA_desaturase" amino acids 66 to 331 (266 residues), 54.9 bits, see alignment E=5.7e-19

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a192)

Predicted SEED Role

"Fatty acid desaturase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1U8 at UniProt or InterPro

Protein Sequence (357 amino acids)

>Pf6N2E2_3995 Fatty acid desaturase (Pseudomonas fluorescens FW300-N2E2)
MHGTCASSERLNAQQRSAHIRQVVLARGEELRRRYPILRHQDALGAGILAFALAGMIGSA
LLYINGYLAGWACLLLNAFFASLTHELEHDLIHSMYFRKQRLPHNLMMGLVWLARPSTIN
PWIRRHLHLNHHKVSGSEADMEERAITNGEPWGLARLLMVGDNVMSAFIRLLRARTWAHK
RSILKRTLKVYFPLALLHWGAWYVFLGFHGANGIAGLLGTSIDWSATTLATMQVIDIAAV
VIIGPNVLRTFCLHFVSSNMHYYGDIEPGNVIQQTQVLNPWWLWPLQAFCFNFGSSHGIH
HFVVKEPFYIRQLTVPVAHKVMREMGVRFNDFGTFGRANRFVRQEGVVREEGDTVRV