Protein Info for Pf6N2E2_3994 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ferrichrome-iron receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 834 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details PF07660: STN" amino acids 82 to 125 (44 residues), 34.9 bits, see alignment 1.6e-12 PF07715: Plug" amino acids 170 to 275 (106 residues), 91.6 bits, see alignment E=6.7e-30 TIGR01783: TonB-dependent siderophore receptor" amino acids 172 to 834 (663 residues), 466.9 bits, see alignment E=6.1e-144 PF00593: TonB_dep_Rec_b-barrel" amino acids 351 to 803 (453 residues), 233.8 bits, see alignment E=1.1e-72

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 96% identity to pba:PSEBR_a193)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0G4 at UniProt or InterPro

Protein Sequence (834 amino acids)

>Pf6N2E2_3994 Ferrichrome-iron receptor (Pseudomonas fluorescens FW300-N2E2)
MTERVPLKNPFGFSAQPGLLRQAIHAALFSTALGVSVVPMLAVAAQNGVTASRQSYNIAP
GPLSDVLNQFARQAGITLASTPAQTGGVQSPGLKGEYSPDQALSQLLSGSGLVAVSQDGS
SYVLQTETAGSTLELPTTDIKGFALGNALGSMEGYNATHSQVATKTSTALRETSQSVSVV
TREQMDDQGAQTVSQAMRYTPGVLTNPYGATHRYDYVAMRGFNDGSVDNIYLDGLKSMGD
SGTYSSMQVDPYFLERVDILKGPSSVLYGRSSPGGLVALTSKKPQYEAYHQIQATVGTQG
QRGMGFDFTGPVDDDKRITYRLIGLADTSDTQFDHNKEKRFALAPTVNIDFSEDTSLTLQ
AYLQHDPDGGYHGGMPADGTLHQRNGRRISEHFFEGEPGIDRYERDQQSFGYQFEHRFND
VFTARQNFRYLDSEVKNDQVYAYDWTTPTSNELNRYYTGAEEKLHSFIVDNMLQAEFFTG
ATKHTVLMGADYQRRKTVVDWTSGSLAPINAFDPVYGNSAITGRYNTSYLRRLEQTGVYL
QDLIEMDKWRFSLGLRQDWVQTSDENRIAEFGRPEGTEINDKRTKLTGRAGALYLFDNGL
APYISYSESFNPNSYADSAGNPLPPTDGKQWELGLKYQPPGTDDLYTASLFRIDQENLAT
KLPQDNFYRAVGAVRSQGLELEAHLQLTEQLKVLGSYTFTDIEYSKSMISTLSTPTDIIE
NKGNSPTQAPRHMASVWADYKFDSGTLDGLRLGGGVRYVGYSWADAENTMKVPSYTLFDA
SVGYDLSKVGLKGVDVRLNANNLTNESYVASCASLSFCYMGEERNVAATVSYQF