Protein Info for Pf6N2E2_3979 in Pseudomonas fluorescens FW300-N2E2

Annotation: Type I secretion system ATPase, LssB family LapB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 721 transmembrane" amino acids 171 to 195 (25 residues), see Phobius details amino acids 209 to 226 (18 residues), see Phobius details amino acids 281 to 305 (25 residues), see Phobius details amino acids 311 to 328 (18 residues), see Phobius details amino acids 393 to 418 (26 residues), see Phobius details amino acids 424 to 448 (25 residues), see Phobius details TIGR03375: type I secretion system ATPase" amino acids 23 to 717 (695 residues), 971.7 bits, see alignment E=1e-296 PF00664: ABC_membrane" amino acids 176 to 435 (260 residues), 78.3 bits, see alignment E=8.5e-26 PF00005: ABC_tran" amino acids 504 to 653 (150 residues), 111.1 bits, see alignment E=7e-36

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a208)

Predicted SEED Role

"Type I secretion system ATPase, LssB family LapB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GMU4 at UniProt or InterPro

Protein Sequence (721 amino acids)

>Pf6N2E2_3979 Type I secretion system ATPase, LssB family LapB (Pseudomonas fluorescens FW300-N2E2)
VQSVESEVSPVELVHDPRTLHDDPLLDGLLALCMLHQKPASAAMLTTGLPLPKQRLSVEL
LSRAAARAGLQGRVLQRKLEQIPTIAMPALLLLKDGRSAVLLGWVGDDQARLLLSESDGG
EVTISRELLADDYSGKVFFAQPQHKFDVNHGTLIPRARSWFRDTLKRSRWLYADAIAASL
LINIIAMAAPLFVMNVYDRVVPNQAESTLWVLAVGIIGAYVFDLILKMLRSLCLDLAGKK
TDLIISATLFERIVGMSMKYRPARVGSFAQNIHEFQSLRDFLASLTLTSLIDLPFTLLIF
MVIAIIGGHLVWIPVLAFPIALLIGYALQKPLVATMERTMALGAERQSSLIETLAGLDAV
KVNNAESERQYQWEQTIGTLSRLELRVKMLSGLAMNITLLIQQLAGVIMIVFGVYLIIAG
NLSMGGLVACYMLSGRALSPLASLSGLLTRYQQARVTMTSVDQMMELPQERNFDERPLSR
KVLQGAVECRQLNFTYPNQQNPALKNINLVIKPGEKIGIIGRSGSGKSSLAKLLVGLYQP
DDGALLVDGVDIRQIDVSELRYNIGYVPQDIQLLAGTLRDNLTSGARYVEDELVLQAAEL
AGVHEFARLHPQGYELQVGERGQNLSGGQRQNVALARALLLNPPILLLDEPTSAMDNTGE
ERLKQRLAAVVENKTVLLVTHRASLLSLVDRLLVIDRGQILADGPKAAVMEALKKGQISV
A