Protein Info for Pf6N2E2_3978 in Pseudomonas fluorescens FW300-N2E2

Annotation: Type I secretion system, membrane fusion protein LapC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 29 to 445 (417 residues), 426.2 bits, see alignment E=7.5e-132 PF13533: Biotin_lipoyl_2" amino acids 72 to 106 (35 residues), 25.5 bits, see alignment 1.8e-09 PF16576: HlyD_D23" amino acids 266 to 364 (99 residues), 30.3 bits, see alignment E=5.2e-11 PF13437: HlyD_3" amino acids 296 to 404 (109 residues), 59.1 bits, see alignment E=1.3e-19

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a209)

Predicted SEED Role

"Type I secretion system, membrane fusion protein LapC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZYU9 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Pf6N2E2_3978 Type I secretion system, membrane fusion protein LapC (Pseudomonas fluorescens FW300-N2E2)
VGRYFKGSDSLHGQPLPEVNKALIEDAPRVVRLTIWGIIGFFVFLALWANFAVIDEVTKG
DGKAIPSSKIQKVQNLEGGIVAELFVKEGQIVEAGAPLIRLDDTRFVSNVGETEADRLSM
LLRVERLSAEVDDRPLNFPADVLKAVPGQAASEESLYISRRQQLHDEIGGLQEQLIQRQQ
ELREFVSKQAQYRSGLALQRQEINMSEPLVAQGAVSPVEVLRLKRAEVETRGQLDATTLA
IPRAESAIKEVQRKIDETRGKFRSDALTQLNEARTDLNKAQATGKALEDRVSRTLVTSPV
RGIVNKLLVNTIGGVIQPGSDLVEIVPLDDTILVEAKIRPQDIAFLHPGQDATVKFTAYD
YTIYGGMKAKLEQIGADTITDEDKKTTYYIIKLRTERSHLGTDEKPLLIIPGMVASVDII
TGKKTVLSYLLKPIIKARAEALHER