Protein Info for Pf6N2E2_3976 in Pseudomonas fluorescens FW300-N2E2

Annotation: Taurine-binding periplasmic protein TauA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF13379: NMT1_2" amino acids 65 to 274 (210 residues), 38.2 bits, see alignment E=1.5e-13 PF09084: NMT1" amino acids 65 to 268 (204 residues), 21.9 bits, see alignment E=1.4e-08

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 97% identity to pba:PSEBR_a211)

Predicted SEED Role

"Taurine-binding periplasmic protein TauA" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0N1 at UniProt or InterPro

Protein Sequence (341 amino acids)

>Pf6N2E2_3976 Taurine-binding periplasmic protein TauA (Pseudomonas fluorescens FW300-N2E2)
MSKRIAFAPLAAAIGLGFSLLAGSLVTPASAHAEGEIRIAEQFGIVYLLLNVVRDQQLIE
KHGKQEGIEIKVDWTQLSGGAAVNDALLSGSIDIAGAGVGPLLTVWDRTRGKQNVKAVAS
LGNFPYYLLSNNPKVKTIADFTEKDRIAVPAVGVSVQSRFLQYAAAKQWGDKDFNRLDKY
TLAVPHPDATAALIAGGTELTGHFSNPPFQDQALQNPSVHVVLNSYDVLGPNSPTVLFAT
EKFRDENPKTYKAFVEALTEAAEFAQNDKGAAADTYLRVTQAKIDRATLLKIIDNPQIEF
TVNPKNTYPLAEFLYRVGAIKNKPASWEDYFFQDAKPLQGS