Protein Info for Pf6N2E2_3972 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cell division inhibitor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 91% identity to pba:PSEBR_a215)

Predicted SEED Role

"Cell division inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0E8 at UniProt or InterPro

Protein Sequence (162 amino acids)

>Pf6N2E2_3972 Cell division inhibitor (Pseudomonas fluorescens FW300-N2E2)
MPVPQSTLRKALVVWLYAAALMHLLAGITLSWAGHGGLLDGYLQNIEQAFWGAAAVPATA
RAQQVWWLALFGATLQSYALYMLALVHIGNRLKRAMPWGWIIAGILLWAPQDMLISAQAR
VWSHLWFDSLALLVLLPPLFWLYRHDRRTSLTDHAPSDANHA