Protein Info for Pf6N2E2_3947 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cd(II)/Pb(II)-responsive transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 PF13411: MerR_1" amino acids 1 to 68 (68 residues), 76.9 bits, see alignment E=1.6e-25 TIGR02047: Cd(II)/Pb(II)-responsive transcriptional regulator" amino acids 1 to 127 (127 residues), 203.5 bits, see alignment E=5e-65 PF00376: MerR" amino acids 2 to 39 (38 residues), 61.4 bits, see alignment E=8.8e-21 PF09278: MerR-DNA-bind" amino acids 45 to 108 (64 residues), 69.6 bits, see alignment E=4.2e-23

Best Hits

Swiss-Prot: 35% identical to MERR_STAAU: Mercuric resistance operon regulatory protein (merR) from Staphylococcus aureus

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a241)

Predicted SEED Role

"Cd(II)/Pb(II)-responsive transcriptional regulator" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WUE7 at UniProt or InterPro

Protein Sequence (148 amino acids)

>Pf6N2E2_3947 Cd(II)/Pb(II)-responsive transcriptional regulator (Pseudomonas fluorescens FW300-N2E2)
MKIGELAKITDCQVETIRYYEREGLLPEPARSDGNYRVYTQAHAERLTFIRNCRTLDMTL
EEIRSLLALRDSPQDQCESVNALIDEHIQHVKARIDGLLALQTQLIDLRHRCGEGPDLDQ
CGILQRLEVSGAVAPEVEHSHVGRSHGH