Protein Info for Pf6N2E2_3934 in Pseudomonas fluorescens FW300-N2E2

Annotation: Fumarylacetoacetate hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF01557: FAA_hydrolase" amino acids 19 to 220 (202 residues), 187 bits, see alignment E=1.8e-59

Best Hits

Swiss-Prot: 49% identical to YCGM_ECOLI: Uncharacterized protein YcgM (ycgM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a253)

Predicted SEED Role

"Fumarylacetoacetate hydrolase family protein" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A2P5 at UniProt or InterPro

Protein Sequence (221 amino acids)

>Pf6N2E2_3934 Fumarylacetoacetate hydrolase family protein (Pseudomonas fluorescens FW300-N2E2)
MSYQHQYVDGTRIHFPVGKVVCIGRNYAEHAKELDNPVPTEPLLFIKPGSCVVPLEGGFS
IPADRGSVHYEAEIAVLIGKPLSTKPSAEEVLDAISGFAPALDLTLRDKQAELKAKGLPW
EVAKSFDGAAVLAPFVSNGTFADLTDIPVRLTINGEVRQDGNSSLMLNPIVPMIQYMAGC
FSLQAGDVILTGTPAGVGPLNAGDELVLELPGASRFESSVR