Protein Info for Pf6N2E2_3927 in Pseudomonas fluorescens FW300-N2E2

Annotation: Methionine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 PF00005: ABC_tran" amino acids 51 to 199 (149 residues), 130.5 bits, see alignment E=1.1e-41 PF09383: NIL" amino acids 298 to 355 (58 residues), 37.9 bits, see alignment E=1.9e-13

Best Hits

Swiss-Prot: 84% identical to METN2_PSEPF: Methionine import ATP-binding protein MetN 2 (metN2) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02071, D-methionine transport system ATP-binding protein (inferred from 96% identity to pba:PSEBR_a260)

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZYQ9 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Pf6N2E2_3927 Methionine ABC transporter ATP-binding protein (Pseudomonas fluorescens FW300-N2E2)
MNAVNARLRQEAPPPRSAKHTELHPELNRAHVRFIGLGKTYNGAQGPLAALQGIDLAIQR
GEVFGIIGRSGAGKSSLIRTINRLEQPTSGRVLIDQIDIGEFDEDRLVELRRRIGMIFQH
FNLMSAKTVWQNVELPLKVAGVPKEQRQRKVHELLELVGLQGKHKAYPAQLSGGQKQRVG
IARALVHDPQILLCDEATSALDPETTQSILGLLREINQRLGLTIVLITHEMAVIREVCDR
VVVLEQGRIVEQGPVWEVFGNPQHEVSRTMLAPLQHAIPEELQSRLQALPASADAATVLR
LQFTGIGRDEPDLAALFNALDGRVRLLHGGIERIQGHGLGQLLLAVSGSSWSAEELRQRA
GNWAQQVEVLGYVV