Protein Info for Pf6N2E2_3912 in Pseudomonas fluorescens FW300-N2E2

Annotation: Alpha-ketoglutarate-dependent taurine dioxygenase (EC 1.14.11.17)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF02668: TauD" amino acids 6 to 271 (266 residues), 243.5 bits, see alignment E=2e-76

Best Hits

Swiss-Prot: 60% identical to TAUD_ECOLI: Alpha-ketoglutarate-dependent taurine dioxygenase (tauD) from Escherichia coli (strain K12)

KEGG orthology group: K03119, taurine dioxygenase [EC: 1.14.11.17] (inferred from 96% identity to pba:PSEBR_a274)

MetaCyc: 60% identical to taurine dioxygenase (Escherichia coli K-12 substr. MG1655)
Taurine dioxygenase. [EC: 1.14.11.17]

Predicted SEED Role

"Alpha-ketoglutarate-dependent taurine dioxygenase (EC 1.14.11.17)" in subsystem Alkanesulfonate assimilation or Taurine Utilization (EC 1.14.11.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.17

Use Curated BLAST to search for 1.14.11.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1N4 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Pf6N2E2_3912 Alpha-ketoglutarate-dependent taurine dioxygenase (EC 1.14.11.17) (Pseudomonas fluorescens FW300-N2E2)
MNRPTITPLSTALGAQISGIDISQPLSQEHRTTIEQVLLTHQVLFFRDQPIDPTQQARFA
AYFGDLHIHPIYPNVPEQPEVLVLDTAVTDVRDNAVWHTDVTFLPTPAMGAVLSAKLLPA
FGGDTLWASGIAAYEALSAPLKRLLEGLTATHDFTRSFPLERFGNTAEDLARWEEARRKN
PPLSHPVIRTHPVSGRRSLFVNEGFTTRINELSETESEVILKLLFAHATRPEFTLRWRWQ
VNDVAFWDNRVTQHFAVDDYRPARRVMHRATVLGDVPFFR