Protein Info for Pf6N2E2_3909 in Pseudomonas fluorescens FW300-N2E2

Annotation: Taurine-binding periplasmic protein TauA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF04069: OpuAC" amino acids 26 to 235 (210 residues), 83.3 bits, see alignment E=5.7e-27 TIGR01729: taurine ABC transporter, periplasmic binding protein" amino acids 28 to 323 (296 residues), 447 bits, see alignment E=1.7e-138 PF13379: NMT1_2" amino acids 29 to 237 (209 residues), 50.4 bits, see alignment E=7.1e-17 PF12974: Phosphonate-bd" amino acids 48 to 220 (173 residues), 40.3 bits, see alignment E=6.7e-14 PF09084: NMT1" amino acids 54 to 244 (191 residues), 81.7 bits, see alignment E=1.9e-26

Best Hits

Swiss-Prot: 55% identical to TAUA_ECOLI: Taurine-binding periplasmic protein (tauA) from Escherichia coli (strain K12)

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 98% identity to pba:PSEBR_a277)

MetaCyc: 55% identical to taurine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"Taurine-binding periplasmic protein TauA" in subsystem Taurine Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A2R4 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Pf6N2E2_3909 Taurine-binding periplasmic protein TauA (Pseudomonas fluorescens FW300-N2E2)
MSLRFPLRLLAAASLAVTSFFVQAADLTVAYQTTVDPAKVAQADGAYEKATQAKIDWRKF
DNGADVITAIASGDVQIGYLGSSPLTAAITRKVPVETFLIATQIGAAEALVVRDGSGINS
PQDLIGKKIAVPFVSTGHYSLLAALKHWNIDPSKVTVLNLAPPAIIAAWKRGDIDATYVW
DPALGVAKENGKVLITSAELAKFGAPTFDAWIVRKDFAQKHPEIVTAFAKVTLDAYAQYR
KDPQAWLADASNVDKLVKLSGAKASDIPLLLQGNVFPLAADQVVSLGAPTTQAITDTAAF
LKEQGKVDAVLPDYAPYVSAKYIAR