Protein Info for Pf6N2E2_3893 in Pseudomonas fluorescens FW300-N2E2

Annotation: putative 4-hydroxybenzoyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 PF20791: Acyl-ACP_TE_C" amino acids 9 to 36 (28 residues), 21.5 bits, see alignment 3.4e-08 PF13279: 4HBT_2" amino acids 16 to 134 (119 residues), 66.2 bits, see alignment E=5.9e-22 PF03061: 4HBT" amino acids 23 to 106 (84 residues), 49.2 bits, see alignment E=8.4e-17

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 99% identity to pba:PSEBR_a293)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZI94 at UniProt or InterPro

Protein Sequence (139 amino acids)

>Pf6N2E2_3893 putative 4-hydroxybenzoyl-CoA thioesterase (Pseudomonas fluorescens FW300-N2E2)
MPQRNEYRHLQAITTRWHDNDVYGHVNNVTYYSFFDSAVNTYLIEVGGLDIHDGEVVGFV
VSSACDYFASIAFPDRIEIGLRVGKLGSSSVQYELAVFKVGEEEACAAGRFVHVFVDRAS
NRPVAIPDRLRGALELLVV