Protein Info for Pf6N2E2_3858 in Pseudomonas fluorescens FW300-N2E2

Annotation: Amino acid ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 19 to 41 (23 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 10 to 116 (107 residues), 76 bits, see alignment E=1.4e-25 PF00528: BPD_transp_1" amino acids 32 to 222 (191 residues), 66.7 bits, see alignment E=1.1e-22

Best Hits

Swiss-Prot: 50% identical to OCCM_RHIRD: Octopine transport system permease protein OccM (occM) from Rhizobium radiobacter

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 96% identity to pba:PSEBR_a327)

MetaCyc: 40% identical to L-arginine ABC transporter membrane subunit ArtM (Escherichia coli K-12 substr. MG1655)
ABC-4-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0I8 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Pf6N2E2_3858 Amino acid ABC transporter, permease protein (Pseudomonas fluorescens FW300-N2E2)
MNWDVIIKWLPKLAQGATLTLELVAIAVLAGLLLAIPLGIARSSRLWQVRALPYAYIFFF
RGTPLLVQLFLVYYGLAQFEAVRSSAMWPYLRDPFWCATATMTLHTAAYIAEILRGAIQA
IPRGEIEAARALGMSRPKALFYIMLPRAARIGLPAYSNEVILMLKASALASTVTLLELTG
MARTIIARTYLPVEIFFAAGMFYLLMSYLLVQGFKQLERWLRVDACQGR