Protein Info for Pf6N2E2_3829 in Pseudomonas fluorescens FW300-N2E2

Annotation: Protein export cytoplasm chaperone protein (SecB, maintains protein to be exported in unfolded state)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 TIGR00809: protein-export chaperone SecB" amino acids 12 to 147 (136 residues), 185 bits, see alignment E=3.3e-59 PF02556: SecB" amino acids 12 to 150 (139 residues), 191.5 bits, see alignment E=3.4e-61

Best Hits

Swiss-Prot: 98% identical to SECB_PSEFL: Protein-export protein SecB (secB) from Pseudomonas fluorescens

KEGG orthology group: K03071, preprotein translocase subunit SecB (inferred from 98% identity to pba:PSEBR_a354)

Predicted SEED Role

"Protein export cytoplasm chaperone protein (SecB, maintains protein to be exported in unfolded state)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1G8 at UniProt or InterPro

Protein Sequence (160 amino acids)

>Pf6N2E2_3829 Protein export cytoplasm chaperone protein (SecB, maintains protein to be exported in unfolded state) (Pseudomonas fluorescens FW300-N2E2)
MTDQQNTAASEEEAAPQFSLQRIYVRDLSFEAPKSPAIFRQQWEPSVGLDLNTRQKALED
DFHEVVLTLSVTVKNGEEVAFIAEVQQAGIFLIKNLDAASMSHTLGAFCPNILFPYARET
LDSLVTRGSFPALMLAPVNFDALYAQELQRMQQEGGATVQ