Protein Info for Pf6N2E2_3792 in Pseudomonas fluorescens FW300-N2E2

Annotation: Glucans biosynthesis protein G precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 580 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF04349: MdoG" amino acids 28 to 498 (471 residues), 630.2 bits, see alignment E=1.3e-193

Best Hits

Swiss-Prot: 76% identical to OPGG_PSEPK: Glucans biosynthesis protein G (opgG) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03670, periplasmic glucans biosynthesis protein (inferred from 92% identity to pba:PSEBR_a391)

Predicted SEED Role

"Glucans biosynthesis protein G precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GTY5 at UniProt or InterPro

Protein Sequence (580 amino acids)

>Pf6N2E2_3792 Glucans biosynthesis protein G precursor (Pseudomonas fluorescens FW300-N2E2)
MTAKRFRNALVAGSALLCLFGAGQLWAFSLDDVSAKAQELAGQKFEAPRSNLPNEFREMK
FADYQKIRFRTEKAEWADQKTPFRLSFYHQGMHFDTPVKINEITATTVDEIKYDPTRFDF
GDVKFDPKATEQLGYAGFRVLYPINKADKQDEIMTMLGASYFRVIGKGQVYGLSARGMAI
DTALPSGEEFPRFREFWIQRPKPTDKHLVIFALLDSPRATGAYRLIVRPGTDTVVDVKSR
VFLRDRVNKLGIAPLTSMFLFGANQPSKVLNYRRELHDSSGLSIHAGNGEWIWRPLNNPK
HLAVSNFSVENPRGFGLLQRGRDFSHYEDLDDRYEKRPSAWIEPKGDWGKGTVDLVEIPT
ADETNDNIVAFWSPEKLPEPGQPLDFAYRLHWTLDEANLHSPDSAWVKQTLRSTGDVKQS
NLIRQPDGSVAYLVDFEGPSLQALPEEAEVRSQVSVGDNAEIVENSVRYNPETKGWRLTL
RLKIKDPSKATEMRAALVRPLVPVELPATAHSVATLAKADKVAKQQSEKEQANEQAGEQK
ETKAVKASTAVAEPIPTQQEPEQTEQVLTETWSYQLPADE